Ccdc28b (NM_025455) Mouse Recombinant Protein

CAT#: TP502023

Purified recombinant protein of Mouse coiled coil domain containing 28B (Ccdc28b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202023 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEDKKKKRSPKPCLTQQAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRAGKEKCRPVLAGGGG
  GSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCG
  EEEDEEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEDQPAA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079731
• Locus ID: 66264
• UniProt ID: Q8CEG5
• Cytogenetics: 4 D2.2
• Refseq Size: 856
• Refseq ORF: 603
• Synonyms: 1110002E08Rik; 1810010N17Rik
• Summary: Involved in ciliogenesis. Regulates cilia length through its interaction with MAPKAP1/SIN1 but independently of mTORC2 complex. Modulates mTORC2 complex assembly and function, possibly enhances AKT1 phosphorylation. Does not seem to modulate assembly and function of mTORC1 complex.[UniProtKB/Swiss-Prot Function]