Cradd (NM_009950) Mouse Recombinant Protein

CAT#: TP502001

Purified recombinant protein of Mouse CASP2 and RIPK1 domain containing adaptor with death domain (Cradd), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202001 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEIKAQTTGLRKTMLLLDILPSRGPKAFD
  TFLDSLQEFPWVREKLEKAREEVTAELPTGDWMAGIPSHILSSSPSDQQINQLAQRLGPEWEPVVLSLGL
  SQTDIYRCKANHPHNVHSQVVEAFVRWRQRFGKQATFLSLHKGLQAVEADPSLLQHMLE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034080
• Locus ID: 12905
• UniProt ID: O88843, Q549T4
• Cytogenetics: 10 49.26 cM
• Refseq Size: 1650
• Refseq ORF: 600
• Synonyms: RAIDD
• Summary: Adapter protein that associates with PIDD1 and the caspase CASP2 to form the PIDDosome, a complex that activates CASP2 and triggers apoptosis. Also recruits CASP2 to the TNFR-1 signaling complex through its interaction with RIPK1 and TRADD and may play a role in the tumor necrosis factor-mediated signaling pathway.[UniProtKB/Swiss-Prot Function]