Dusp14 (NM_019819) Mouse Recombinant Protein

SKU TP501991

Purified recombinant protein of Mouse dual specificity phosphatase 14 (Dusp14), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201991 protein sequence; Red=Cloning site Green=Tags(s); ; MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRASVASNWHLLQARGITCVINATIEIPNFNWPQ; FEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNW; VKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMVQTPYGIIPDVYEKESRHLMPYWGI; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_062793
• Locus ID: 56405
• UniProt ID: Q9JLY7
• Cytogenetics: 11 51.29 cM
• RefSeq Size: 1443
• RefSeq ORF: 594
• Synonyms: 1110014C10Rik; 2310042C07Rik; D11Ertd395e; MKP-L; Mkp6
• Summary: Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases.[UniProtKB/Swiss-Prot Function]