Agr2 (NM_011783) Mouse Recombinant Protein

CAT#: TP501533

Purified recombinant protein of Mouse anterior gradient 2 (Agr2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201533 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEKFSVSAILLLVAISGTLAKDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNR
  PLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRAD
  ITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 19.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035913
• Locus ID: 23795
• UniProt ID: O88312
• Cytogenetics: 12 A3
• Refseq Size: 760
• Refseq ORF: 528
• Synonyms: Agr2h; Gob-4; HAG-2; mAG-2; XAG-2
• Summary: Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth (By similarity). Promotes cell adhesion (By similarity).[UniProtKB/Swiss-Prot Function]