Dctpp1 (NM_023203) Mouse Recombinant Protein

CAT#: TP501423

Purified recombinant protein of Mouse dCTP pyrophosphatase 1 (Dctpp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201423 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTAGDGERGTVGQEDSAAARPFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL
  FQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYPVHLSRGSACK
  YTDLPRGTISENQAVGAGDPASELRDQAST
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 18.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075692
• Locus ID: 66422
• UniProt ID: Q9QY93
• Cytogenetics: 7 F3
• Refseq Size: 648
• Refseq ORF: 513
• Synonyms: 2410015N17Rik; AI854235; RS21-C6
• Summary: Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for dCTP and its analogs including 5-iodo-dCTP and 5-methyl-dCTP for which it may even have a higher efficiency. May protect DNA or RNA against the incorporation of these genotoxic nucleotide analogs through their catabolism.[UniProtKB/Swiss-Prot Function]