OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Lmo4 (NM_010723) Mouse Recombinant Protein

Be the first to review this product
SKU
TP501329
Purified recombinant protein of Mouse LIM domain only 4 (Lmo4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Lmo4 or NM_010723"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR201329 protein sequence
Red=Cloning site Green=Tags(s)

MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM
ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD
RPTALINGHLNSLQSNPLLPDQKVC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 18 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_034853
Locus ID 16911
UniProt ID P61969
Cytogenetics 3 68.61 cM
RefSeq Size 1704
RefSeq ORF 495
Synonyms A730077C12Rik; Crp3; Etohi4
Summary Probable transcriptional factor.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Cisplatin-induced ototoxicity is mediated by nitroxidative modification of cochlear proteins characterized by nitration of Lmo4
Jamesdaniel, Coling, Hinduja et al
J. Biol. Chem. (2012) 287 (22), 18674-86 DOI: 10.1074/jbc.M111.297960
Cited by 6
AI Summary: OriGene’s recombinant Lmo4 protein was used in this study to investigate the effects of nitroxidative modification, specifically nitration, on Lmo4 in the context of cisplatin-induced ototoxicity.
Snippet: MS/MS Analysis of Nitrated Lmo4. A suspension containing 0.2 mg/ml recombinant Lmo4 protein (OriGene, Rockville, MD) was nitrated by incubating with 0.17 mm peroxynitrite (Cayman Chemical, Ann Arbor, MI) in 25 mm Tris buffer (pH 7.3) for 30 min at 37 °C (25).
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products