OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Eif5a (NM_181582) Mouse Recombinant Protein

Be the first to review this product
SKU
TP501137
Purified recombinant protein of Mouse eukaryotic translation initiation factor 5A (Eif5a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Eif5a or NM_181582"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR201137 protein sequence
Red=Cloning site Green=Tags(s)

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE
DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA
MTEEAAVAIKAMAK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 17.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_853613
Locus ID 276770
UniProt ID P63242
Cytogenetics 11 B3
RefSeq Size 1361
RefSeq ORF 462
Synonyms AA410058; D19Wsu54; D19Wsu54e; eIF-4D; eIF-5A; eIF-5A-1; eIF-5A1; Eif4d; Eif5a1
Summary This gene encodes an elongation initiation factor, which participates in protein synthesis. The encoded protein also plays roles in mRNA metabolism, cell proliferation, and cell cycle control. This protein contains a modified lysine residue called hypusine, which appears to be necessary for its function. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 2, 5, and 19. provided by RefSeq, Oct 2009
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Characterization of a novel polyclonal anti-hypusine antibody
Nishiki, Farb, Friedrich et al
Springerplus (2013) 2, 421 DOI: 10.1186/2193-1801-2-421
Cited by 32
AI Summary: OriGene contributed to this study by providing purified human DHH protein, which was used in the in vitro hypusination reactions to characterize the novel polyclonal anti-hypusine antibody.
Snippet: Purified hu- man DHH protein was purchased from OriGene. The hypusination reactions in vitro proceeded as previously published (Wolff et al. ... 2010)), this observation may reflect the long half-life (6–24 h) of the hypusinated eIF5A protein in mammalian cells (Gerner et al.
FigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products