Calml3 (NM_027416) Mouse Recombinant Protein

CAT#: TP501049

Purified recombinant protein of Mouse calmodulin-like 3 (Calml3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201049 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADQLTEEQIAEFKEAFSLFDKDGDGSITTQELGTVMRSLGQNPTEAELQGMVNEIDKDGNGTVDFPKFL
  TMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGEKLSDEEVDEMIQAADTDGDGQVNYE
  EFVHMLVSK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 16.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081692
• Locus ID: 70405
• UniProt ID: Q9D6P8
• Cytogenetics: 13 A1
• Refseq Size: 1426
• Refseq ORF: 450
• Synonyms: 2310068O22Rik; AI326174
• Summary: May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates (By similarity).[UniProtKB/Swiss-Prot Function]