Pole3 (NM_021498) Mouse Recombinant Protein

CAT#: TP500969

Purified recombinant protein of Mouse polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200969 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVL
  SAMEEMEFQRFITPLKEALEAYRREQKGKKEASEQKKKDKDKKDSEEQDKSREEEEEDEERLDEDDQNEE
  EEIDN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 16.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067473
• Locus ID: 59001
• UniProt ID: Q9JKP7, A0A0R4J091
• Cytogenetics: 4 B3
• Refseq Size: 617
• Refseq ORF: 438
• Synonyms: 1810034K18Rik; YBL1
• Summary: Forms a complex with DNA polymerase epsilon subunit CHRAC1 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome-remodeling activity of ISWI/SNF2H and ACF1.[UniProtKB/Swiss-Prot Function]