OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rgcc (NM_025427) Mouse Recombinant Protein

Be the first to review this product
SKU
TP500841
Purified recombinant protein of Mouse regulator of cell cycle (Rgcc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Rgcc or NM_025427"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR200841 representing NM_025427
Red=Cloning site Green=Tags(s)

MKPPSAQSSPAAVAAAAPAMDSAAAADLTDVLCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSD
SSGFSDSESADSVYRDSFTFSDEKLNSPTNSSPALLPSAVTPRKAKLGDTKELEDFIADLDRTLASM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 15.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079703
Locus ID 66214
UniProt ID Q9DBX1
Cytogenetics 14 D3
RefSeq Size 934
RefSeq ORF 411
Synonyms 1190002H23Rik; Rgc-32; Rgc32
Summary Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic factor contributing to the pathogenesis of renal fibrosis through fibroblast activation.UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products