Fabp3 (NM_010174) Mouse Recombinant Protein

CAT#: TP500776

Purified recombinant protein of Mouse fatty acid binding protein 3, muscle and heart (Fabp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200776 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIE
  FDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 14.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034304
• Locus ID: 14077
• UniProt ID: P11404, Q5EBJ0
• Cytogenetics: 4 63.43 cM
• Refseq Size: 669
• Refseq ORF: 402
• Synonyms: Fabph-1; Fabph-4; Fabph1; Fabph4; H-FABP; Mdgi
• Summary: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.[UniProtKB/Swiss-Prot Function]