Fabp4 (NM_024406) Mouse Recombinant Protein

SKU TP500762

Purified recombinant protein of Mouse fatty acid binding protein 4, adipocyte (Fabp4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200762 protein sequence; Red=Cloning site Green=Tags(s); ; MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVE; FDEITADDRKVKSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVMKGVTSTRVYERA; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 14.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_077717
• Locus ID: 11770
• UniProt ID: P04117
• Cytogenetics: 3 2.56 cM
• RefSeq Size: 646
• RefSeq ORF: 396
• Synonyms: 422/aP2; ALBP/Ap2; Ap2; Lbpl
• Summary: Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.[UniProtKB/Swiss-Prot Function]