OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Calca (NM_001033954) Mouse Recombinant Protein

Be the first to review this product
SKU
TP500706SE
Purified recombinant protein of Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), (Secreted), 20ug
Size:
20 ug
  $900.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA364397 Calcitonin gene-related peptide 1 (alpha-CGRP), guinea pig anti canine/mouse/rat, polyclonal.
50 ul
$855.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Calca or NM_001033954"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by MR200706
Blue=ORF Red=Cloning site Green=Tag(s)

MGFLKFSPFLVVSILLLYQACSLQAVPLRSILESSPGMATLSEEEVRLLAALVQDYMQMKARELEQEEE
QEAEGSSVTAQKRSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAFGRRRRDLQA
myc-FLAG tag

Recombinant protein using MR200706 also available, TP500706
Tag C-Myc/DDK
Predicted MW 14.9 kDa
Concentration >50 ug/mL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
Preparation Conditioned medium was collected from overexpressed HEK293 cells. Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001029126
Locus ID 12310
UniProt ID Q99JA0
Cytogenetics 7 59.99 cM
RefSeq Size 1022
RefSeq ORF 384
Synonyms C; CA; Calc; Calc1; Cg; Cgrp; CGRP-1; CGRP1; Ct; Ctn
Summary This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide (CGRP) and katacalcin. Alternative splicing of the mRNA results in multiple variants that encode either calcitonin or CGRP preproproteins. Post-translational processing of the calcitonin and CGRP propeptides results in either calcitonin and katacalcin, or CGRP, respectively. Calcitonin and katacalcin modulate calcium levels in the blood stream. CGRP can function as a vasodilator and play a role in the transmission of pain. The human homolog of CGRP was found to have antimicrobial activity. provided by RefSeq, Mar 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products