1810054D07Rik (BC020085) Mouse Recombinant Protein

CAT#: TP500536

Purified recombinant protein of Mouse RIKEN cDNA 1810054D07 gene (cDNA clone MGC:28310 IMAGE:4013480), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200536 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLNLKYNVKGTSDFIIMEDRLHTEWSSLTWTAFHMGNNLNPSQSISKTSLLQEEAARRALLCIEVAEQVL
  SLNHAEEGFVDAAPSPSNCTVYSDRVSTVLLRQDFVCKDQSSCLTVFK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 13.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 69863
• UniProt ID: Q8BYY4
• Cytogenetics: 4 C3
• Refseq Size: 641
• Refseq ORF: 354
• Synonyms: RP23-17O21.2
• Summary: Regulates high density lipoprotein (HDL) cholesterol metabolism by promoting the ubiquitination and degradation of the oxysterols receptors LXR (NR1H2 and NR1H3).[UniProtKB/Swiss-Prot Function]