Mrpl17 (BC010718) Mouse Recombinant Protein

SKU TP500494

Purified recombinant protein of Mouse mitochondrial ribosomal protein L17 (cDNA clone MGC:6922 IMAGE:2811255), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200494 protein sequence; Red=Cloning site Green=Tags(s); ; MRLSLAAAISHGRVYRRLGLGPESRIHLLRNLLTGLVRHERIEATWARADEMRGYAEKLIDYGKLGDTNE; RAMRMADFWLTVSAPYLLVRKESLENRVPGRLKAGHSFMYQTCELP; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 13.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• Locus ID: 27397
• UniProt ID: Q9D8P4
• Cytogenetics: 7 E3
• RefSeq Size: 1039
• RefSeq ORF: 348
• Synonyms: MRP-L26; Rpml26