Hmga1 (NM_001039356) Mouse Recombinant Protein

CAT#: TP500385

Purified recombinant protein of Mouse high mobility group AT-hook 1 (Hmga1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200385 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA
  KTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 11.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034445
• Locus ID: 15361
• UniProt ID: P17095, Q566K0
• Cytogenetics: 17 14.5 cM
• Refseq Size: 1794
• Refseq ORF: 324
• Synonyms: AL023995; Hmg; HMG-I(Y; Hmga; Hmga1a; Hmga1b; Hmgi; HMGI(Y; Hmgiy; Hmgy
• Summary: This locus encodes a member of the nuclear, non-histone high mobility group protein family. This architectural transcription factor binds to A-T rich DNA sequences and participates in enhanceosome formation, chromatin remodeling and regulation of transcription. This protein functions in many cellular processes, including cell growth and differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]