OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Pf4 (NM_019932) Mouse Recombinant Protein

Be the first to review this product
SKU
TP500359
Purified recombinant protein of Mouse platelet factor 4 (Pf4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Pf4 or NM_019932"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR200359 representing NM_019932
Red=Cloning site Green=Tags(s)

MSVAAVFRGLRPSPELLLLGLLFLPAVVAVTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRH
CAVPQLIATLKNGRKICLDRQAPLYKKVIEKILES

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 11.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064316
Locus ID 56744
UniProt ID Q9Z126
Cytogenetics 5 E1
RefSeq Size 525
RefSeq ORF 315
Synonyms Cxcl4; Scyb4
Summary Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Chemokines, Cytokines, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Pf4" proteins (1)
SKU Description Size Price
TP723860 Purified recombinant protein of Mouse platelet factor 4 (Pf4 / PF-4) 10 ug
$345.00

file-alt Citations

Critical role of CXCL4 in the lung pathogenesis of influenza (H1N1) respiratory infection
Guo, Feng, Wang et al
Mucosal Immunol (2017)
AI Summary: OriGene’s recombinant CXCL4 protein was used to treat CXCL4-deficient mice, enabling the researchers to specifically assess the role of CXCL4 in influenza-induced lung pathology.
Snippet: To demonstrate CXCL4-specific effects in the CXCL4 −/− mice, H1N1-infected CXCL4 −/− mice were given recombinant CXCL4 (5 μg per mouse) (OriGene, Beijing, China) on day 0 and daily postinfection by intravenous injection via the retro-orbital plexus as described ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products