Ccl22 (NM_009137) Mouse Recombinant Protein

CAT#: TP500244

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 22 (Ccl22), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200244 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATLRVPLLVALVLLAVAIQTSDAGPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITV
  KNRDICADPRQVWVKKLLHKLS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 10.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033163
• Locus ID: 20299
• UniProt ID: O88430, Q546S6
• Cytogenetics: 8 C5
• Refseq Size: 1815
• Refseq ORF: 279
• Synonyms: ABCD-1; DCBCK; MDC; Scya22
• Summary: Chemotactic for activated T-lymphocytes. May play an important role in the collaboration of dendritic cells and B-lymphocytes with T-cells in immune responses.[UniProtKB/Swiss-Prot Function]