Timm8b (NM_013897) Mouse Recombinant Protein

CAT#: TP500170

Purified recombinant protein of Mouse translocase of inner mitochondrial membrane 8B (Timm8b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200170 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGSRLDSRTENCLSSCVDRFIDTTLAI
  TGRFAQIVQKGGQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 9.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_038925
• Locus ID: 30057
• UniProt ID: P62077
• Cytogenetics: 9 A5.3
• Refseq Size: 527
• Refseq ORF: 252
• Synonyms: Tim8b
• Summary: Probable mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).[UniProtKB/Swiss-Prot Function]