2310003F16Rik (BC021588) Mouse Recombinant Protein

CAT#: TP500088

Purified recombinant protein of Mouse RIKEN cDNA 2310003F16 gene (cDNA clone MGC:35660 IMAGE:5116361), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200088 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDRRSREQKAK
  QER
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 8.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 67693
• UniProt ID: Q9CR41
• Cytogenetics: 2 E5
• Refseq Size: 739
• Refseq ORF: 219
• Synonyms: HYPK, HSPC136
• Summary: Has a chaperone-like activity preventing polyglutamine (polyQ) aggregation of HTT. Protects against HTT polyQ-mediated apoptosis in neuronal cells. Required for optimal NAA10-NAA15 complex-mediated N-terminal acetylation (By similarity).[UniProtKB/Swiss-Prot Function]