Gng11 (NM_025331) Mouse Recombinant Protein

CAT#: TP500085

Reviews ()
Write a review

Purified recombinant protein of Mouse guanine nucleotide binding protein (G protein), gamma 11 (Gng11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



USD 823.00


Availability*
6 Weeks

Size
    • 20 ug


Product images

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200085 protein sequence
Red=Cloning site Green=Tags(s)

MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSC
VIS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 8.5 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079607
Locus ID 66066
UniProt ID P61953
Cytogenetics 6 A1
Refseq Size 849
Refseq ORF 222
Synonyms 0610037B21Rik
Summary Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction (By similarity).[UniProtKB/Swiss-Prot Function]

Documents

Other products for "Gng11"
Frequently bought together (1)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 385.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.