Tmsb4x (NM_021278) Mouse Recombinant Protein

CAT#: TP500012

Purified recombinant protein of Mouse thymosin, beta 4, X chromosome (Tmsb4x), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200012 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 5.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067253
• Locus ID: 19241
• UniProt ID: P20065, Q6ZWX2
• Cytogenetics: X 78.28 cM
• Refseq Size: 670
• Refseq ORF: 135
• Synonyms: Ptmb4; Tb4
• Summary: Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.[UniProtKB/Swiss-Prot Function]