OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHMP5 (NM_001195536) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP331013
Purified recombinant protein of Homo sapiens chromatin modifying protein 5 (CHMP5), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA808523 CHMP5 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CHMP5 or NM_001195536"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC231013 representing NM_001195536
Red=Cloning site Green=Tags(s)

MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLK
QKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMME
DANEIQEALSRSYGTPELDEDDLEAGWSSGG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001182465
Locus ID 51510
UniProt ID Q9NZZ3
Cytogenetics 9p13.3
RefSeq ORF 513
Synonyms C9orf83; CGI-34; HSPC177; PNAS-2; SNF7DC2; Vps60
Summary CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 PubMed 16730941).supplied by OMIM, Mar 2008
Protein Categories Intracellular Proteins
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CHMP5" proteins (4)
SKU Description Size Price
LC414005 Lyophilized CHMP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434012 Lyophilized CHMP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414005 Transient overexpression lysate of chromatin modifying protein 5 (CHMP5) (as WB positive control) 100 ug
$436.00
LY434012 Transient overexpression lysate of chromatin modifying protein 5 (CHMP5), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products