OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KDM1A (NM_001009999) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP330555
Recombinant protein of human lysine (K)-specific demethylase 1A (KDM1A), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA377750 KDM1 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "KDM1A or NM_001009999"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC230555 representing NM_001009999
Red=Cloning site Green=Tags(s)

MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTPRKKEPPRASP
PGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEE
RNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGGLQDDSSGGYGDGQASGVEGAAFQSRLPHDRMTS
QEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHG
LINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLG
AMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQADTVKVPKEKDEMVEQEFNRLLEATSYLSHQL
DFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEAS
EVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANL
EFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVN
TRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVN
LFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKET
VVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALL
SGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 95.6
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001009999
Locus ID 23028
UniProt ID O60341
Cytogenetics 1p36.12
RefSeq Size 3125
RefSeq ORF 2628
Synonyms AOF2; BHC110; CPRF; KDM1; LSD1
Summary This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants. provided by RefSeq, Apr 2009
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KDM1A" proteins (4)
SKU Description Size Price
LC402400 Lyophilized KDM1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433555 Lyophilized KDM1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402400 Transient overexpression lysate of lysine (K)-specific demethylase 1A (KDM1A), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY433555 Transient overexpression lysate of lysine (K)-specific demethylase 1A (KDM1A), transcript variant 1 (as WB positive control) 100 ug
$665.00

file-alt Citations

Novel epigenetic biomarkers following ferroptosis and pyroptosis in a hypobaric hypoxia-induced renal injury model
Liu, Lin, He et al
Arch Biochem Biophys (2025) 774, 110637 DOI: 10.1016/j.abb.2025.110637
Cited by 1
AI Summary: OriGene's recombinant LSD1 protein (Cat# TP330555) was used to assess binding affinity in the study, contributing to the analysis of molecular interactions relevant to hypobaric hypoxia-induced renal injury.
Snippet: A Biacore T200 (GE Healthcare, Chicago, IL, USA) instrument was used to measure binding affinity at 25 °C. LSD1 was purchased from OriGene (Wuxi OriGene Biotechnology Co., Ltd., TP330555, Wuxi, China). Briefly, FA was diluted to the specified concentration with a running buffer (10 μmol/L HEPES plus 0.1% DMSO)
LSD1 inhibition sensitizes anti-PD1 blockade immunotherapy by inhibiting the long-range attack of tumor-derived extracellular vesicles
Zhao, Zhang, Meng et al
Acta Pharmaceutica Sinica B (2025)
Cited by 6
AI Summary: OriGene’s recombinant LSD1 protein (catalog #TP330555) was used in binding affinity assays to investigate the interaction between LSD1 and potential inhibitors in this study.
Snippet: A Biacore T200 (GE Healthcare, Chicago, IL, USA) instrument was used to measure binding affinity at 25 °C. LSD1 was purchased from OriGene (Wuxi OriGene Biotechnology Co., Ltd., TP330555, Wuxi, China). Briefly, FA was diluted to the specified concentration with a running buffer (10 μmol/L HEPES plus 0.1% DMSO)
ZNF750 interacts with KLF4 and RCOR1, KDM1A, and CTBP1/2 chromatin regulators to repress epidermal progenitor genes and induce differentiation genes
Boxer, Barajas, Tao et al
Genes Dev. (2014) 28 (18), 2013-26 DOI: 10.1101/gad.246579.114
Cited by 155
AI Summary: OriGene products—including recombinant ZNF750, KLF4, KDM1A, CTBP1, and CTBP2 proteins—were used in this study to investigate the molecular interactions by which ZNF750 regulates epidermal progenitor and differentiation genes.
Snippet: The following recombinant proteins were purchased or purified: ZNF750 (Origene), MBP (Prospec), KLF4 (Origene), RCOR1 (Abnova), KDM1A (Origene), CTBP1 (Origene), CTBP2 (Origene)
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products