OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SENP8 (NM_001166340) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP329692
Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA804753 SENP8 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SENP8 or NM_001166340"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC229692 representing NM_001166340
Red=Cloning site Green=Tags(s)

MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAE
IAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFL
GRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLA
KK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.6
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001159812
Locus ID 123228
UniProt ID Q96LD8
Cytogenetics 15q23
RefSeq ORF 636
Synonyms DEN1; NEDP1; PRSC2
Summary This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants.provided by RefSeq, Oct 2009
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SENP8" proteins (7)
SKU Description Size Price
PH306791 SENP8 MS Standard C13 and N15-labeled recombinant protein (NP_660205) 10 ug
$3,360.00
LC407943 Lyophilized SENP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432692 Lyophilized SENP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407943 Transient overexpression lysate of SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432692 Transient overexpression lysate of SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306791 Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), 20 µg 20 ug
$867.00
TP720150 Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1. 10 ug
$160.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products