OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SNX7 (NM_015976) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP329228
Recombinant protein of human sorting nexin 7 (SNX7), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA345085 Rabbit Polyclonal Anti-SNX7 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SNX7 or NM_015976"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC229228 representing NM_015976
Red=Cloning site Green=Tags(s)

MEGERRASQAPSSGLPAGGANGESPGGGAPFPGSSGSSALLQAEVLDLDEDEDDLEVFSKDASLMDMNSF
SPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIITKTSRGEFDSSEFEVRRRYQD
FLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKALHKFLNRIADHPTLTFNEDFKIFLTA
QAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEERE
YFDEMKEYGPIHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMK
RRDQIQAELDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFTDMAEEN
IHYYEQCLATWESFLTSQTNLHLEEASEDKP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057060
Locus ID 51375
UniProt ID Q9UNH6
Cytogenetics 1p21.3
RefSeq ORF 1353
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like some family members, and its exact function is unknown. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 11. provided by RefSeq, Jun 2010
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SNX7" proteins (4)
SKU Description Size Price
LC407673 Lyophilized SNX7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432249 Lyophilized SNX7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407673 Transient overexpression lysate of sorting nexin 7 (SNX7), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432249 Transient overexpression lysate of sorting nexin 7 (SNX7), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products