OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF580 (NM_001163423) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP328746
Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ZNF580 or NM_001163423"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228746 protein sequence
Red=Cloning site Green=Tags(s)

MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLE
EEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRA
THRARAGPPHTCPLCPRRFQDAAELAQHVRLH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001156895
Locus ID 51157
UniProt ID Q9UK33
Cytogenetics 19q13.42
RefSeq Size 1046
RefSeq ORF 516
Summary Involved in the regulation of endothelial cell proliferation and migration. Mediates H(2)O(2)-induced leukocyte chemotaxis by elevating interleukin-8 production and may play a role in inflammation. May be involved in transcriptional regulation.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF580" proteins (10)
SKU Description Size Price
PH304398 ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_996998) 10 ug
$3,360.00
PH314316 ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_057286) 10 ug
$3,360.00
LC404118 Lyophilized ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414134 Lyophilized ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431774 Lyophilized ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404118 Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY414134 Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431774 Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP304398 Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 2, 20 µg 20 ug
$737.00
TP314316 Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products