OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FAM90A13 (NM_001164456) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP328386
Purified recombinant protein of Homo sapiens family with sequence similarity 90, member A13 (FAM90A13), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FAM90A13 or NM_001164456"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228386 representing NM_001164456
Red=Cloning site Green=Tags(s)

MMARRDPTSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVP
ATLGKKEGKENLKPWKPRGEANPGPLNKDKGEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTEPS
DYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVLASLSPLRKASLSSSSSLGPKERQTGAAADM
PQPAVRHQGREPLLVVKPTHSRPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGL
GSNLSFGPGAKRPAQAPIQACLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGR
RTPAQVPSVDRQPPHSRPCLPTAQACTMSHHPAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001157928
Locus ID 441314
Cytogenetics 8p23.1
RefSeq ORF 1392
Synonyms FAM90A13
Summary FAM90A13 belongs to subfamily II of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements (Bosch et al., 2007 PubMed 17684299). For background information on the FAM90A gene family, as well as information on the evolution of FAM90A genes, see FAM90A1 (MIM 613041).supplied by OMIM, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FAM90A13" proteins (2)
SKU Description Size Price
LC431414 Lyophilized FAM90A13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY431414 Transient overexpression lysate of family with sequence similarity 90, member A13 (FAM90A13) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products