OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tropomodulin 2 (TMOD2) (NM_001142885) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP327766
Purified recombinant protein of Homo sapiens tropomodulin 2 (neuronal) (TMOD2), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA334550 Rabbit Polyclonal Anti-TMOD2 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tropomodulin 2 or NM_001142885"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227766 representing NM_001142885
Red=Cloning site Green=Tags(s)

MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLL
MYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGV
HNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKAF
ADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILK
FGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001136357
Locus ID 29767
UniProt ID Q9NZR1
Cytogenetics 15q21.2
RefSeq ORF 945
Synonyms N-TMOD; NTMOD
Summary This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. provided by RefSeq, Dec 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Tropomodulin 2" proteins (7)
SKU Description Size Price
PH309053 TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_055363) 10 ug
$3,360.00
PH327766 TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001136357) 10 ug
$3,360.00
LC415226 Lyophilized TMOD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428294 Lyophilized TMOD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415226 Transient overexpression lysate of tropomodulin 2 (neuronal) (TMOD2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428294 Transient overexpression lysate of tropomodulin 2 (neuronal) (TMOD2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309053 Recombinant protein of human tropomodulin 2 (neuronal) (TMOD2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products