OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FAM90A7 (NM_001136572) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP326842
Purified recombinant protein of Homo sapiens family with sequence similarity 90, member A7 (FAM90A7), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FAM90A7 or NM_001136572"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226842 representing NM_001136572
Red=Cloning site Green=Tags(s)

MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRSPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVP
ATLGKKEGKENLKPWKPRAEANPGPLNKDKGEKEERPRQQDPQRNALLHMFSGKPPEKPLPNGKGSTESS
EHLRVASGPMPVHTTSKRPRVDPVLADRSATEMSGRGSVLASLSPLRKASLSSSSSLGPKERQTGAAADI
PQPAFRHQGPEPLLVVKPTHSSPEGGCREVPQAASKTHGLLQAVRPQAQDKRPAVTSQPCPPAATHSLGL
GSNLSFGPGAKRPAQAPIQACLNFPKKPRLGPFQIPESAIQGGELRAPENLQPPPAATELGPSTSPQMGR
RTPAQVPSVDRQPPHSTPCLPTAQACTMSHHPAAGHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001130044
Locus ID 441317
Cytogenetics 8p23.1
RefSeq ORF 1392
Synonyms FAM90A7
Summary FAM90A7 belongs to subfamily II of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements (Bosch et al., 2007 PubMed 17684299). For background information on the FAM90A gene family, as well as information on the evolution of FAM90A genes, see FAM90A1 (MIM 613041).supplied by OMIM, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FAM90A7" proteins (3)
SKU Description Size Price
PH326842 FAM90A7 MS Standard C13 and N15-labeled recombinant protein (NP_001130044) 10 ug
$3,360.00
LC427928 Lyophilized FAM90A7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY427928 Transient overexpression lysate of family with sequence similarity 90, member A7 (FAM90A7) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products