OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NFYC (NM_001142589) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP326680
Purified recombinant protein of Homo sapiens nuclear transcription factor Y, gamma (NFYC), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA330041 Rabbit Polyclonal Anti-NFYC Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NFYC or NM_001142589"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226680 representing NM_001142589
Red=Cloning site Green=Tags(s)

MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKRNDIAMAITKF
DQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQI
IIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQL
QYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFI
QSANQPSDGQAPQVTGD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001136061
Locus ID 4802
UniProt ID Q13952
Cytogenetics 1p34.2
RefSeq ORF 891
Synonyms CBF-C; CBFC; H1TF2A; HAP5; HSM; NF-YC
Summary This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Dec 2008
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Protein Pathways Antigen processing and presentation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NFYC" proteins (13)
SKU Description Size Price
PH300060 NFYC MS Standard C13 and N15-labeled recombinant protein (NP_055038) 10 ug
$3,360.00
PH326680 NFYC MS Standard C13 and N15-labeled recombinant protein (NP_001136061) 10 ug
$3,360.00
LC402291 Lyophilized NFYC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428190 Lyophilized NFYC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428191 Lyophilized NFYC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428192 Lyophilized NFYC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428193 Lyophilized NFYC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402291 Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428190 Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY428191 Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428192 Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY428193 Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP300060 Recombinant protein of human nuclear transcription factor Y, gamma (NFYC), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products