OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ABLIM2 (NM_001130088) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP325796
Recombinant protein of human actin binding LIM protein family, member 2 (ABLIM2), transcript variant 7, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373164 ABLIM2 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ABLIM2 or NM_001130088"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225796 representing NM_001130088
Red=Cloning site Green=Tags(s)

MSAVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYI
CTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSV
GSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLNAEYISKDGLPYCEADYHAKFGI
RCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSS
ESIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGES
PQLLSPTPTEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRPAARRSDGEDGSLDQDNRKQK
SSWLMLKGDADTRTNSPDLDTQSLSHSSGTDRDPLQRMAGDSFHSREWFF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001123560
Locus ID 84448
UniProt ID Q6H8Q1
Cytogenetics 4p16.1
RefSeq ORF 1410
Summary May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Pathways Axon guidance
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ABLIM2" proteins (17)
SKU Description Size Price
PH325796 ABLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_001123560) 10 ug
$3,360.00
PH326056 ABLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_001123555) 10 ug
$3,360.00
LC410126 Lyophilized ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427151 Lyophilized ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427152 Lyophilized ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427153 Lyophilized ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427154 Lyophilized ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427155 Lyophilized ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427156 Lyophilized ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410126 Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 6 (as WB positive control) 100 ug
$665.00
LY427151 Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427152 Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427153 Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY427154 Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY427155 Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY427156 Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 7 (as WB positive control) 100 ug
$436.00
TP326056 Purified recombinant protein of Homo sapiens actin binding LIM protein family, member 2 (ABLIM2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products