OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ASPDH (NM_001114598) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP325390
Recombinant protein of human aspartate dehydrogenase domain containing (ASPDH), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808667 ASPDH mouse monoclonal antibody, clone OTI4G8 (formerly 4G8) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ASPDH or NM_001114598"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225390 representing NM_001114598
Red=Cloning site Green=Tags(s)

MADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGERRPDL
VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAA
GGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVI
GVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGI
HLC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001108070
Locus ID 554235
UniProt ID A6ND91
Cytogenetics 19q13.33
RefSeq ORF 849
Summary Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ASPDH" proteins (7)
SKU Description Size Price
PH325390 ASPDH MS Standard C13 and N15-labeled recombinant protein (NP_001108070) 10 ug
$3,360.00
LC422526 Lyophilized ASPDH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426491 Lyophilized ASPDH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422526 Transient overexpression lysate of aspartate dehydrogenase domain containing (ASPDH), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426491 Transient overexpression lysate of aspartate dehydrogenase domain containing (ASPDH), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP760231 Recombinant protein of human aspartate dehydrogenase domain containing (ASPDH), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00
TP760327 Purified recombinant protein of Homo sapiens aspartate dehydrogenase domain containing (ASPDH), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products