OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Bcl2 Binding component 3 (BBC3) (NM_001127240) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP325345M
Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 1, 100 µg
Size:
100 ug 20 ug 1 mg
  $2,950.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321834 Anti-BBC3 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Bcl2 Binding component 3 or NM_001127240"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225345 representing NM_001127240
Red=Cloning site Green=Tags(s)

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSV
LRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGV
ARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHH
GTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001120712
Locus ID 27113
UniProt ID Q96PG8
Cytogenetics 19q13.32
RefSeq ORF 783
Synonyms JFY-1; JFY1; PUMA
Summary This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2011
Protein Families Druggable Genome
Protein Pathways Huntington's disease, p53 signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Using CETSA assay and a mathematical model to reveal dual Bcl-2/Mcl-1 inhibition and on-target mechanism for ABT-199 and S1
Guo, Song, Xue et al
Eur J Pharm Sci (2020) 142, 105105 DOI: 10.1016/j.ejps.2019.105105
Cited by 12
AI Summary: OriGene products contributed to this study by providing the Bcl-2 (Cat# TP300904) and Mcl-1 (Cat# TP301905) recombinant proteins used in the CETSA assays to assess drug-protein binding and target engagement.
Using CETSA assay and a mathematical model to reveal dual Bcl-2/Mcl-1 inhibition and on-target mechanism for ABT-199 and S1
Guo, Song, Xue et al
Eur J Pharm Sci (2019) 142, 105105 DOI: 10.1016/j.ejps.2019.105105
AI Summary: OriGene products Bim (LY416580), Puma (TP325345), Bax (RC204368), and Bak (RC201216) were used in this study to investigate the roles of pro-apoptotic proteins in validating the on-target effects of BH3 mimetic drugs on Bcl-2 family proteins.
Snippet: Recombinant human Bcl-2 and Mcl-1 were obtained as our report described (Zhang et al., 2011), Bim (LY416580), Puma (TP325345), Bax (RC204368), Bak (RC201216) were purchased from OriGene (Beijing, China). Immunoblotting;- Recombinant human Bcl-2 and Mcl-1 were obtained as our report described (Zhang et al., 2011), Bim (LY416580), Puma (TP325345), Bax (RC204368), Bak (RC201216) were purchased from OriGene (Beijing, China). …
HER2 Phosphorylates and Destabilizes Pro-Apoptotic PUMA, Leading to Antagonized Apoptosis in Cancer Cells
Carpenter, Han, Paw et al
PLoS ONE (2013) 8 (11), e78836 DOI: 10.1371/journal.pone.0078836
Cited by 21
AI Summary: OriGene’s recombinant human PUMA protein was used as a substrate in phosphorylation and dephosphorylation assays to investigate how HER2 modifies and destabilizes PUMA in cancer cells.
Snippet: Recombinant human PUMA protein (Origene, Rockville, MD) was dephosphorylated with recombinant human PTP1B protein at 30°C followed by PTP1B inactivation at 65°C. Dephosphorylated PUMA was then incubated with recombinant human HER2 protein (Promega ... Cite SaveSaving
FigureFigureFigure
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products