OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM240 (NM_001114748) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP325178
Recombinant protein of human chromosome 1 open reading frame 70 (C1orf70), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TMEM240 or NM_001114748"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225178 representing NM_001114748
Red=Cloning site Green=Tags(s)

MSMSANTMIFMILGASVVMAIACLMDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHIHYVIPYDGDQSV
VDASENYFVTDSVTKQEIDLMLGLLLGFCISWFLVWMDGVLHCAVRAWRAGRRYDGSWTWLPKLCSLREL
GRRPHRPFEEAAGNMVHVKQKLYHNGHPSPRHL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 19.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001108220
Locus ID 339453
UniProt ID Q5SV17
Cytogenetics 1p36.33
RefSeq ORF 519
Synonyms C1orf70; SCA21
Summary This gene encodes a transmembrane-domain containing protein found in the brain and cerebellum. Mutations in this gene result in spinocerebellar ataxia 21. provided by RefSeq, Dec 2014
Protein Categories Intracellular Proteins, Membrane Proteins, Nervous system: Neurodegenerative diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM240" proteins (3)
SKU Description Size Price
PH325178 C1orf70 MS Standard C13 and N15-labeled recombinant protein (NP_001108220) 10 ug
$3,360.00
LC426507 Lyophilized TMEM240 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY426507 Transient overexpression lysate of chromosome 1 open reading frame 70 (C1orf70) (as WB positive control) 100 ug
$436.00

file-alt Citations

The TMEM240 Protein, Mutated in SCA21, Is Expressed in Purkinje Cells and Synaptic Terminals
Homa, Loyens, Eddarkaoui et al
Cerebellum (2020)
Cited by 9
AI Summary: In this study, recombinant human TMEM240 protein from OriGene was used as a control in immunohistochemistry experiments to validate the specificity of TMEM240 antibody labeling in mouse brain tissue.
Snippet: immunohistochemistry. In each experiment, we used mouse cerebellum lysate as a positive control and incubated it with the sera alone or with either the antigenic peptide or recombinant human TMEM240 protein (Origene, Herford, Germany)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products