OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NAA60 (NM_001083600) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324843
Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA378903 NAA60 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NAA60 or NM_001083600"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224843 representing NM_001083600
Red=Cloning site Green=Tags(s)

MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAE
IKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVL
TTNNTAINFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQHLGSALASLSPCSIP
HRVYRQAHSLLCSFLPWSGISSKSGIEYSRTM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001077069
Locus ID 79903
UniProt ID Q9H7X0
Cytogenetics 16p13.3
RefSeq Size 2642
RefSeq ORF 726
Synonyms HAT4; hNaa60; NAT15; NatF
Summary This gene encodes an enzyme that localizes to the Golgi apparatus, where it transfers an acetyl group to the N-terminus of free proteins. This enzyme acts on histones, and its activity is important for chromatin assembly and chromosome integrity. Alternative splicing and the use of alternative promoters results in multiple transcript variants. The upstream promoter is located in a differentially methylated region (DMR) and undergoes imprinting; transcript variants originating from this position are expressed from the maternal allele. provided by RefSeq, Nov 2015
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NAA60" proteins (11)
SKU Description Size Price
PH313483 NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_001077070) 10 ug
$3,360.00
PH317832 NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_079121) 10 ug
$3,360.00
PH324843 NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_001077069) 10 ug
$3,360.00
LC411017 Lyophilized NAA60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421226 Lyophilized NAA60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421227 Lyophilized NAA60 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411017 Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421226 Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY421227 Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP313483 Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 1, 20 µg 20 ug
$867.00
TP317832 Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products