ROR1 (NM_001083592) Human Recombinant Protein

CAT#: TP324765M

Recombinant protein of human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, 100 µg

Product Images

Coomassie blue staining of purified ROR1 protein (Cat# TP324765). The protein was produced from HEK293T cells transfected with ROR1 cDNA clone (Cat# RC224765) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224765 representing NM_001083592
  Red=Cloning site Green=Tags(s)
  
  MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTS
  LGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVV
  SSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIG
  TSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP
  NCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTAL
  RFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001077061
• Locus ID: 4919
• UniProt ID: Q01973
• Cytogenetics: 1p31.3
• Refseq Size: 2303
• Refseq ORF: 1179
• Synonyms: dJ537F10.1; NTRKR1
• Summary: This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. This gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2012]
• Protein Families: Druggable Genome, Protein Kinase, Transmembrane