KGF (FGF7) (NM_002009) Human Recombinant Protein
CAT#: TP324418
Recombinant protein of human fibroblast growth factor 7 (keratinocyte growth factor) (FGF7), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224418 representing NM_002009
Red=Cloning site Green=Tags(s) MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLF CRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFK ELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002000 |
Locus ID | 2252 |
UniProt ID | P21781 |
Cytogenetics | 15q21.2 |
Refseq Size | 3853 |
Refseq ORF | 582 |
Synonyms | HBGF-7; KGF |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400734 | FGF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400734 | Transient overexpression lysate of fibroblast growth factor 7 (keratinocyte growth factor) (FGF7) |
USD 436.00 |
|
PH324418 | FGF7 MS Standard C13 and N15-labeled recombinant protein (NP_002000) |
USD 3,255.00 |
|
TP721204 | Purified recombinant protein of Human fibroblast growth factor 7 (FGF7) |
USD 330.00 |
|
TP750010 | Recombinant protein of human Fibroblast Growth Factor-7 (KGF) produced in E. coli. |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review