OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRMT1 (NM_001536) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324239M
Recombinant protein of human protein arginine methyltransferase 1 (PRMT1), transcript variant 1, 100 µg
Size:
100 ug 20 ug 1 mg
  $2,508.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380386 PRMT1 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PRMT1 or NM_001536"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224239 representing NM_001536
Red=Cloning site Green=Tags(s)

MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE
VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVT
IIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKD
YKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDY
VHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFT
IDLDFKGQLCELSCSTDYRMR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity In vitro methylation assay (enzyme) (PMID: 26221041)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001527
Locus ID 3276
UniProt ID Q99873
Cytogenetics 19q13.33
RefSeq Size 1386
RefSeq ORF 1113
Synonyms ANM1; HCP1; HRMT1L2; IR1B4
Summary This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. provided by RefSeq, Dec 2011
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Dynamic arginine methylation of TNF receptor associated factor 6 regulates Toll-like receptor signaling
Tikhanovich, Kuravi, Artigues et al
J. Biol. Chem. (2015)
AI Summary: OriGene products, including pCMV6-TRAF6, pCMV6-PRMT1 plasmids, and recombinant human PRMT1, were used in this study to express and assay TRAF6 and PRMT1, enabling the investigation of arginine methylation’s regulatory role in Toll-like receptor signaling.
Snippet: pCMV6-TRAF6 and pCMV6-PRMT1 were from Origene. ... In vitro activity assays In vitro methylation assay was performed in a reaction mixture containing purified Flag-TRAF6 (wt or mutants), 50 µM SAM, 0.5 µg of recombinant human PRMT1 (Origene) in 1x PBS buffer ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products