OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PAOX (NM_207128) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324235
Recombinant protein of human polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 5, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA335328 Rabbit Polyclonal Anti-PAOX Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PAOX or NM_207128"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224235 representing NM_207128
Red=Cloning site Green=Tags(s)

MESTGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHW
IHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQ
TREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCVSGTHSMDLVALAPFGE
YTVLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPA
HHVIVTVPLGFLREHLDTFFDPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLE
DAAPELQDAWFRKLIGFVVLPAFASVHVLCGFIAGLESEFMETLSDEEVLLCLTQVLRRVTAPDPVCGGS
HTSHVLLHDARGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLLTDFSLA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_997011
Locus ID 196743
UniProt ID Q6QHF9
Cytogenetics 10q26.3
RefSeq Size 1720
RefSeq ORF 1458
Synonyms PAO
Summary Flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion (PubMed:12477380). Can also oxidize N(1)-acetylspermidine to putrescine. Substrate specificity: N(1)-acetylspermine = N(1)-acetylspermidine > N(1),N(12)-diacylspermine >> spermine. Does not oxidize spermidine. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs (PubMed:12477380).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PAOX" proteins (9)
SKU Description Size Price
PH321583 PAOX MS Standard C13 and N15-labeled recombinant protein (NP_997010) 10 ug
$3,360.00
PH324235 PAOX MS Standard C13 and N15-labeled recombinant protein (NP_997011) 10 ug
$3,360.00
LC404057 Lyophilized PAOX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404058 Lyophilized PAOX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407209 Lyophilized PAOX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404057 Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY404058 Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 5 (as WB positive control) 100 ug
$665.00
LY407209 Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP321583 Purified recombinant protein of Homo sapiens polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 4, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products