OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SFTPB (NM_198843) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324088
Recombinant protein of human surfactant protein B (SFTPB), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA346044 Rabbit Polyclonal Anti-SFTPB Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SFTPB or NM_198843"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224088 protein sequence
Red=Cloning site Green=Tags(s)

MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQ
ECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHL
GLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWL
CRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMD
DSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLV
PRGWDAHTTCQALGVCGTMSSPLQCIHSPDL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_942140
Locus ID 6439
UniProt ID P07988
Cytogenetics 2p11.2
RefSeq Size 2854
RefSeq ORF 1143
Synonyms PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Summary This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.provided by RefSeq, Feb 2010
Protein Categories Intracellular Proteins, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SFTPB" proteins (5)
SKU Description Size Price
PH324088 SFTPB MS Standard C13 and N15-labeled recombinant protein (NP_942140) 10 ug
$3,360.00
LC404785 Lyophilized SFTPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424653 Lyophilized SFTPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404785 Transient overexpression lysate of surfactant protein B (SFTPB), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424653 Transient overexpression lysate of surfactant protein B (SFTPB), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

Pulmonary Surfactant Proteins are Inhibited by IgA Autoantibodies in Severe COVID-19
Sinnberg, Lichtensteiger, Hasan Ali et al
Am J Respir Crit Care Med (2022)
Cited by 1
AI Summary: OriGene’s recombinant pulmonary surfactant-associated protein B (Cat. No. TP324088) and protein C (Cat. No. TP303246) were used as antigens in ELISA assays to detect IgA autoantibodies in patient samples, helping demonstrate that these autoantibodies target and inhibit lung surfactant proteins in severe COVID-19.
Snippet: …TP324088 or Cat. … TP303246, respectively;or in-house expressed in HEK293 cells and affinity-purified) were coated in 100 µL of 0.05 M carbonate-bicarbonate buffer, pH 9.6 per well using 96-well flat-bottom MediSorp plates (Thermo Fisher Scientific) at 4 °C overnight. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products