ARMS2 (NM_001099667) Human Recombinant Protein

CAT#: TP323747M

Recombinant protein of human age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein, 100 µg

Product Images

Coomassie blue staining of purified ARMS2 protein (Cat# TP323747). The protein was produced from HEK293T cells transfected with ARMS2 cDNA clone (Cat# RC223747) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223747 representing NM_001099667
  Red=Cloning site Green=Tags(s)
  
  MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK
  IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001093137
• Locus ID: 387715
• UniProt ID: P0C7Q2
• Cytogenetics: 10q26.13
• Refseq Size: 823
• Refseq ORF: 321
• Synonyms: ARMD8
• Summary: This gene encodes a small secreted protein specific to primates. This protein is a component of the choroidal extracellular matrix of the eye. Mutations in this gene are associated with age-related macular degeneration. [provided by RefSeq, Sep 2017]