OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

METTL21D (VCPKMT) (NM_024558) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323670
Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "METTL21D or NM_024558"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223670 representing NM_024558
Red=Cloning site Green=Tags(s)

MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRS
VLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFI
LMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEY
RSEDIHIIYIRKKKSKFPS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_078834
Locus ID 79609
UniProt ID Q9H867
Cytogenetics 14q21.3
RefSeq Size 1784
RefSeq ORF 687
Synonyms C14orf138; METTL21D; VCP-KMT
Summary Protein-lysine N-methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "METTL21D" proteins (7)
SKU Description Size Price
PH316594 C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_001035752) 10 ug
$3,360.00
PH323670 C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_078834) 10 ug
$3,360.00
LC411191 Lyophilized VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421803 Lyophilized VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411191 Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421803 Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP316594 Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products