WFDC3 (NM_080614) Human Recombinant Protein

CAT#: TP322831M

Recombinant protein of human WAP four-disulfide core domain 3 (WFDC3), 100 µg

Product Images

Coomassie blue staining of purified WFDC3 protein (Cat# TP322831). The protein was produced from HEK293T cells transfected with WFDC3 cDNA clone (Cat# RC222831) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222831 representing NM_080614
  Red=Cloning site Green=Tags(s)
  
  MMLSCLFLLKALLALGSLESWITAGEHAKEGECPPDKNPCKELCQGDELCPAEQKCCTTGCGRICRDIPK
  GRKRDCPRVIRKQSCLKRCITDKTCPGVKKCCTLGCNKSCVVPISKQKLAEFGGECPADPLPCEELCDGD
  ASCPQGHKCCSTGCGRTCLGDIEGGRGGDCPKVLVGLCIVGCVMDENCQAGEKCCKSGCGRFCVPPVLPP
  KLTMNPNWTVRSDSELEIPVP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_542181
• Locus ID: 140686
• UniProt ID: Q8IUB2
• Cytogenetics: 20q13.12
• Refseq Size: 1000
• Refseq ORF: 693
• Synonyms: dJ447F3.3; WAP14
• Summary: This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The encoded protein contains four WFDC domains. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Alternatively spliced transcript variants have been observed but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein