PACRG (NM_001080378) Human Recombinant Protein

CAT#: TP322240

Recombinant protein of human PARK2 co-regulated (PACRG), transcript variant 2, 20 µg

Product Images

PARK2 E3 ubiquitin ligase ubiquitinates BCL-XL in vitro. Recombinant proteins BCL-XL and PARK2 (OriGene TP322240) were incubated in HEPES buffer, pH 8.0 containing E1, E2, ubiquitin, and Mg2+-ATP. Reactions were cultured for 10 min at 30 C, then 30 - 60 min at 37 C, and reaction samples were subjected to Western blot analysis with the indicated antibodies. Figure cited from Neoplasia, PMID: 28038320

• 

  Coomassie blue staining of purified PACRG protein (Cat# TP322240). The protein was produced from HEK293T cells transfected with PACRG cDNA clone (Cat# RC222240) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222240 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPT
  AFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGN
  KILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDG
  IDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: In vitro ubiquitination assay (PMID: 28038320)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001073847
• Locus ID: 135138
• UniProt ID: Q96M98
• Cytogenetics: 6q26
• Refseq Size: 1585
• Refseq ORF: 771
• Synonyms: GLUP; HAK005771; PACRG2.1; PARK2CRG
• Summary: This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome