PACRG (NM_001080378) Human Recombinant Protein
CAT#: TP322240
Recombinant protein of human PARK2 co-regulated (PACRG), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222240 protein sequence
Red=Cloning site Green=Tags(s) MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPT AFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGN KILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDG IDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | In vitro ubiquitination assay (PMID: 28038320) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001073847 |
Locus ID | 135138 |
UniProt ID | Q96M98 |
Cytogenetics | 6q26 |
Refseq Size | 1585 |
Refseq ORF | 771 |
Synonyms | GLUP; HAK005771; PACRG2.1; PARK2CRG |
Summary | This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407578 | PACRG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421606 | PACRG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421607 | PACRG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407578 | Transient overexpression lysate of PARK2 co-regulated (PACRG), transcript variant 1 |
USD 436.00 |
|
LY421606 | Transient overexpression lysate of PARK2 co-regulated (PACRG), transcript variant 2 |
USD 436.00 |
|
LY421607 | Transient overexpression lysate of PARK2 co-regulated (PACRG), transcript variant 3 |
USD 436.00 |
|
PH322240 | PACRG MS Standard C13 and N15-labeled recombinant protein (NP_001073847) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review