OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAMK2D (NM_172128) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP322121
Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308736 Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CAMK2D or NM_172128"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222121 protein sequence
Red=Cloning site Green=Tags(s)

MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKH
PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPE
NLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVG
YPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVAS
MMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEI
IKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 53.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_742126
Locus ID 817
UniProt ID Q13557
Cytogenetics 4q26
RefSeq Size 5776
RefSeq ORF 1434
Synonyms CAMKD
Summary The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a delta chain. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Distinct isoforms of this chain have different expression patterns.provided by RefSeq, Nov 2008
Protein Categories Enzyme: Kinases, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAMK2D" proteins (13)
SKU Description Size Price
PH307454 CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742125) 10 ug
$3,360.00
PH318801 CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742113) 10 ug
$3,360.00
PH322121 CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742126) 10 ug
$3,360.00
LC406847 Lyophilized CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406848 Lyophilized CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406849 Lyophilized CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430342 Lyophilized CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406847 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY406848 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY406849 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY430342 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP307454 Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 1, 20 µg 20 ug
$737.00
TP318801 Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 4, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products