OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MASP1 (NM_139125) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP321839
Recombinant protein of human mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MASP1 or NM_139125"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221839 protein sequence
Red=Cloning site Green=Tags(s)

MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESS
YLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDV
DECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSS
ECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFH
SDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECL
KDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVW
MNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSAS
WILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQ
EPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAEC
KTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGV
YTKVSNYVDWVWEQMGLPQSVVEPQVER

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_624302
Locus ID 5648
UniProt ID P48740
Cytogenetics 3q27.3
RefSeq Size 4184
RefSeq ORF 2184
Synonyms 3MC1; CRARF; CRARF1; MAP-1; MAP1; MAp44; MASP; MASP-3; MASP3; PRSS5; RaRF
Summary This gene encodes a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. The encoded protein is synthesized as a zymogen and is activated when it complexes with the pathogen recognition molecules of lectin pathway, the mannose-binding lectin and the ficolins. This protein is not directly involved in complement activation but may play a role as an amplifier of complement activation by cleaving complement C2 or by activating another complement serine protease, MASP-2. The encoded protein is also able to cleave fibrinogen and factor XIII and may may be involved in coagulation. A splice variant of this gene which lacks the serine protease domain functions as an inhibitor of the complement pathway. Alternate splicing results in multiple transcript variants.provided by RefSeq, Apr 2010
Protein Categories Enzyme: Peptidases, Intracellular Proteins, Secreated Proteins
Protein Families Druggable Genome, Protease
Protein Pathways Complement and coagulation cascades
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MASP1" proteins (10)
SKU Description Size Price
PH319651 MASP1 MS Standard C13 and N15-labeled recombinant protein (NP_001870) 10 ug
$3,360.00
PH321839 MASP1 MS Standard C13 and N15-labeled recombinant protein (NP_624302) 10 ug
$3,360.00
LC400702 Lyophilized MASP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408424 Lyophilized MASP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422206 Lyophilized MASP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400702 Transient overexpression lysate of mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY408424 Transient overexpression lysate of mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY422206 Transient overexpression lysate of mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP319651 Recombinant protein of human mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (MASP1), transcript variant 1, 20 µg 20 ug
$867.00
TP720704 Purified recombinant protein of Human mannan-binding lectin serine peptidase 1 (MASP1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products