SPRR2E (NM_001024209) Human Recombinant Protein

CAT#: TP321721

Recombinant protein of human small proline-rich protein 2E (SPRR2E), 20 µg

Product Images

Coomassie blue staining of purified SPRR2E protein (Cat# TP321721). The protein was produced from HEK293T cells transfected with SPRR2E cDNA clone (Cat# RC221721) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221721 representing NM_001024209
  Red=Cloning site Green=Tags(s)
  
  MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPK
  SK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001019380
• Locus ID: 6704
• UniProt ID: P22531
• Cytogenetics: 1q21.3
• Refseq Size: 762
• Refseq ORF: 216
• Summary: This gene encodes a member of a family of small proline-rich proteins clustered in the epidermal differentiation complex on chromosome 1q21. The encoded protein, along with other family members, is a component of the cornified cell envelope that forms beneath the plasma membrane in terminally differentiated stratified squamous epithelia. This envelope serves as a barrier against extracellular and environmental factors. The seven SPRR2 genes (A-G) appear to have been homogenized by gene conversion compared to others in the cluster that exhibit greater differences in protein structure. [provided by RefSeq, Feb 2014]