CLEC2D (NM_001004419) Human Recombinant Protein

CAT#: TP321680M

Recombinant protein of human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2, 100 µg

Product Images

Coomassie blue staining of purified CLEC2D protein (Cat# TP321680). The protein was produced from HEK293T cells transfected with CLEC2D cDNA clone (Cat# RC221680) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221680 representing NM_001004419
  Red=Cloning site Green=Tags(s)
  
  MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC
  LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG
  QPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.1 kDa
• Concentration: >0.1 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001004419
• Locus ID: 29121
• UniProt ID: Q9UHP7
• Cytogenetics: 12p13.31
• Refseq Size: 1821
• Refseq ORF: 582
• Synonyms: CLAX; LLT1; OCIL
• Summary: This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010]
• Protein Families: Druggable Genome, Transmembrane