CD1 (CD1A) (NM_001763) Human Recombinant Protein
CAT#: TP321599
Recombinant protein of human CD1a molecule (CD1A), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221599 representing NM_001763
Red=Cloning site Green=Tags(s) MLFLLLPLLAVLPGDGNADGLKEPLSFHVIWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLWPW SRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDF VSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQRQVKPEAWLSH GPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRV KHSSLEGQDIVLYWEHHSSVGFIILAVIVPLLLLIGLALWFRKRCFC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001754 |
Locus ID | 909 |
UniProt ID | P06126 |
Cytogenetics | 1q23.1 |
Refseq Size | 2072 |
Refseq ORF | 981 |
Synonyms | CD1; FCB6; HTA1; R4; T6 |
Summary | This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to the plasma membrane and to recycling vesicles of the early endocytic system. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Hematopoietic cell lineage |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419760 | CD1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419760 | Transient overexpression lysate of CD1a molecule (CD1A) |
USD 436.00 |
|
PH321599 | CD1A MS Standard C13 and N15-labeled recombinant protein (NP_001754) |
USD 3,255.00 |
|
TP700275 | Purified Recombinant protein of Human CD1a molecule (CD1A), with C-terminal Fc tag, expressed in human cells, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review